PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00030503001
Common NameGSBRNA2T00030503001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 262aa    MW: 29215.2 Da    PI: 4.8499
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00030503001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.4e-373492361
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         e+a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rk+ +s
  GSBRNA2T00030503001 34 ETAPPCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSRS 92
                         56678**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-253486IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5283791IPR003851Zinc finger, Dof-type
PfamPF027011.1E-313791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MMFPYTAHNV CQRQFPSPEI EIPAKWKISY GHEETAPPCP RCASSNTKFC YYNNYSLSQP  60
RYFCKGCRRY WTKGGSLRNI PVGGGCRKRS RSRRQSIHKR FGPNENLPDG LISGSQSSPA  120
GSDIDLAAVF AQYVNAPSPS STDNTTGSDQ DSPVTTTTTT TNTHALNSLS WDICQETDVN  180
LGFYGEFNDL TNKIQEDERG VGHFLQEDQE EIFEFQGLLD DKDIQEILEC SFSEVPEQLI  240
SQGSFMINGH WSSTDLTTFG V*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18792KRSRSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013651627.10.0PREDICTED: dof zinc finger protein DOF1.2-like
RefseqXP_013651625.10.0PREDICTED: dof zinc finger protein DOF1.2-like
SwissprotP683491e-148DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLA0A078J8B70.0A0A078J8B7_BRANA; BnaA07g37300D protein
STRINGBra012277.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-138Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]